PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g062510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 187aa    MW: 21338.2 Da    PI: 4.5643
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g062510.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3521.3e-166851699
                    EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     v+p +f++    +   + t +l+ ++gr W+v++  +k ++++++t GW++F+++++L +g+f++F +++  ++++ v+vf++
  Csa09g062510.1  6 QVIPLSFIKLLADP--FPNTAKLQGTRGRDWTVNM--TKIRDGVYFTVGWSKFAQDHELVDGEFLTFDRVRWYNRTFEVSVFDR 85
                    58999999666655..8889***************..*******************************8855777789999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.915186IPR003340B3 DNA binding domain
SMARTSM010194.2E-6386IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.6E-17485IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-16585IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-14685IPR003340B3 DNA binding domain
CDDcd100173.47E-14784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MCLDHQVIPL SFIKLLADPF PNTAKLQGTR GRDWTVNMTK IRDGVYFTVG WSKFAQDHEL  60
VDGEFLTFDR VRWYNRTFEV SVFDRLSCKE TIVEAETIEL SGSSSDSEAE EDEEPSMDVD  120
YDLSLGNVDI KALTNPHFPT TLKKRIYELL IPGNVLKEND LKFGKTVKYI DEEGTLVGLR  180
MKLNMF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431339.11e-106PREDICTED: B3 domain-containing protein REM20-like
SwissprotQ8LAV51e-57REM20_ARATH; B3 domain-containing protein REM20
TrEMBLR0HPM74e-73R0HPM7_9BRAS; Uncharacterized protein
STRINGscaffold_502422.12e-61(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53310.19e-51B3 family protein